DPCfam | MC333429
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 307 ± 71 aa |
| Residues in low-complexity regions (%) | 4.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F0X977 | 890-1182 | 293 | LVVRTWSVDLVDLRTSNIIHTFRTTTAIKARSLRYLCSKRRQLQIGPPELSHFSLVYSSARTGHCLIQTYLPEQEGGSIALFSND... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W665-F1 | 850-1109 | 83.22 | 68.23 | View in AlphaFoldDB ↗ |