DPCfam | MC333331
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 368 ± 49 aa |
| Residues in low-complexity regions (%) | 2.61 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 8.75 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF11186 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 52.71 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A8HXR1 | 85-476 | 391 | KHINYDEIDAELAWYLNIPIKDNYDIVWLQKASSGTDVTTFFFDICDISYNHIEWTRSSAEDFKNFFDFFKEKKDICVIKHTRED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0P8J2-F1 | 209-609 | 100.00 | 92.39 | View in AlphaFoldDB ↗ |