DPCfam | MC333307
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Residues in low-complexity regions (%) | 2.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07090 |
| Sequences matching dominant architecture (%) | 30.85 |
| Average overlap percent | 36.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B3B19A7 | 350-427 | 78 | MPKTLEDLCRYSVIVLANVSGVEIPESVQKQIESAVRDFGVGLMMTGGDDSFGLGGYFDTPVEKALPVYMDLRNQQEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZLF9-F1 | 65-149 | 94.59 | 97.50 | View in AlphaFoldDB ↗ |