DPCfam | MC33302
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 277 ± 38 aa |
| Residues in low-complexity regions (%) | 11.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 60.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15232 |
| Sequences matching dominant architecture (%) | 93.75 |
| Average overlap percent | 25.58 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007F896D8 | 3533-3799 | 267 | SLPSVSLHASGNASKAAAPKTVAHVSSSPTSHLTNPHSAPVTQYHVESSPYHQSYPLTQRKVLQDLGSGQYFLVDVPVQVKTKTF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3Z1D3-F1 | 1147-1410 | 99.63 | 51.54 | View in AlphaFoldDB ↗ |