DPCfam | MC33293
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 129 ± 20 aa |
| Residues in low-complexity regions (%) | 4.19 |
| Residues in coiled-coil regions (%) | 25.85 |
| Predicted disordered residues (%) | 34.43 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00076 |
| Sequences matching dominant architecture (%) | 1.79 |
| Average overlap percent | 0.97 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00077FD3CD | 162-274 | 113 | LKEKNTLRQGLKVLTGWLKRGDCNKSNNNDFIDMIKYAHNQVWRLMSEKTQIKEELNEEKREVSKGLSNLSDQFEEICRVIEVSR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZYM3-F1 | 273-407 | 99.26 | 91.27 | View in AlphaFoldDB ↗ |