DPCfam | MC332494
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Residues in low-complexity regions (%) | 9.45 |
| Residues in coiled-coil regions (%) | 0.38 |
| Predicted disordered residues (%) | 2.41 |
| Average transmembrane regions | 1.69 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E0NLD8 | 3-83 | 81 | KLKEIMQGRNGVDELNIFLITNALIFKILAYTTHVRLFDMFSVTFLIYSLIRAFSKNIYVRRIENDKIVSVVNKIKRNYKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A133CR15-F1 | 12-96 | 98.82 | 92.25 | View in AlphaFoldDB ↗ |