DPCfam | MC332039
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 135 ± 11 aa |
| Residues in low-complexity regions (%) | 1.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.92 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00096ABCB5 | 6-133 | 128 | YLDLIKQVNIGNYRGRKILAKPIFIIALIEAIEKRISTNNRFFYETLVDLYKQIYHLYIGMNITPMHKPFYHLQNDGFWHIQYIN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GHM9-F1 | 9-142 | 98.55 | 93.03 | View in AlphaFoldDB ↗ |