DPCfam | MC331932
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 921 |
|---|---|
| Mean domain length (aa) | 137 ± 25 aa |
| Residues in low-complexity regions (%) | 2.04 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 10.93 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF01217 |
| Sequences matching dominant architecture (%) | 83.27 |
| Average overlap percent | 90.38 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S7GIM9 | 1-187 | 187 | MVLLAAAVCTKAGKAIVSRQFVEMTRTRIEGLLAAFPKLMNTGKQHTFVETDSVRYVYQPLEKLYMVLITTKNSNILEDLETLRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B2GV08-F1 | 1-137 | 99.22 | 97.19 | View in AlphaFoldDB ↗ |