DPCfam | MC331778
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 265 ± 30 aa |
| Residues in low-complexity regions (%) | 2.73 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 22.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04454 |
| Sequences matching dominant architecture (%) | 84.14 |
| Average overlap percent | 86.5 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I1XTR9 | 2-261 | 260 | DILRKSMAPICDKAWEEINNTAVDLFSSVLSARKFVDVNGPKGLDFAALPLGRIKVPEGQNGEVHYGIQQVLPLIETRVPFELNI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B1L7S2-F1 | 7-263 | 99.26 | 95.60 | View in AlphaFoldDB ↗ |