DPCfam | MC331431
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 179 ± 28 aa |
| Residues in low-complexity regions (%) | 5.01 |
| Residues in coiled-coil regions (%) | 1.13 |
| Predicted disordered residues (%) | 27.57 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF14308 |
| Sequences matching dominant architecture (%) | 91.92 |
| Average overlap percent | 86.46 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M5E6E6 | 106-278 | 173 | THADEARAGFSEIVRLEAEELKQEKYATRTDRSFGVELLHAVGFVYTAKSRHYLAAHGMFGTLSGFFHAASSSIHTVRETVSTLH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CDN0-F1 | 292-458 | 98.80 | 88.26 | View in AlphaFoldDB ↗ |