DPCfam | MC331060
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 4251 |
|---|---|
| Mean domain length (aa) | 131 ± 18 aa |
| Residues in low-complexity regions (%) | 3.76 |
| Residues in coiled-coil regions (%) | 0.76 |
| Predicted disordered residues (%) | 22.29 |
| Average transmembrane regions | 0.19 |
| Dominant Pfam architecture(s) | PF02371 |
| Sequences matching dominant architecture (%) | 97.29 |
| Average overlap percent | 59.52 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009F61A5A | 130-244 | 115 | SDAAIKRSLKAHIRWLDKEIATIEKTIGKQPKTEAIQKTQTLLTSVSGVGSLTASHIIAFLPELGRCDHKSLAALVGVAPFNHDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O53511-F1 | 47-184 | 93.75 | 93.68 | View in AlphaFoldDB ↗ |