DPCfam | MC330713
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1221 |
|---|---|
| Mean domain length (aa) | 216 ± 23 aa |
| Residues in low-complexity regions (%) | 2.76 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 16.61 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF12348 |
| Sequences matching dominant architecture (%) | 87.27 |
| Average overlap percent | 87.86 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X0NWA7 | 22-252 | 231 | EMQRISDILGSGNHTTASGEDWNKRLEALKQLCTLAREDISKRQGFLLLMSTCVKVPLQRHIEEIRTALSVNACGVVVAFAEHSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8RWY6-F1 | 280-500 | 99.07 | 94.19 | View in AlphaFoldDB ↗ |