DPCfam | MC33052
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Residues in low-complexity regions (%) | 15.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.38 |
| Average transmembrane regions | 2.26 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005C1C2C8 | 1-80 | 80 | MHTLIMVACGLGALVLFLLLSGAFGIARSRAVASFLALWMVVALINLWVGVRQAGYTVWQELPFLVVVFGVPAAAAMFAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HZS8-F1 | 1-78 | 98.75 | 96.43 | View in AlphaFoldDB ↗ |