DPCfam | MC330037
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 78 ± 18 aa |
| Residues in low-complexity regions (%) | 7.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07563 |
| Sequences matching dominant architecture (%) | 2.38 |
| Average overlap percent | 23.24 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B9AUT7 | 1-70 | 70 | MKKFALTIFGAAILLGAGSAGALAEGPGKGTDLINFGEMKGHLQQMHPEMNEKELKDMYESCHDTGGAEP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P41208-F1 | 92-153 | 56.25 | 93.73 | View in AlphaFoldDB ↗ |