DPCfam | MC330013
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Residues in low-complexity regions (%) | 1.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09095 |
| Sequences matching dominant architecture (%) | 98.81 |
| Average overlap percent | 45.91 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F8ZRP2 | 471-580 | 109 | VEFNLILPCCDGMNGFYNIPSVDLGEKGLGSSGEIAGIRQMSMVDKWTKMKLVFSFDKETSVWRFPIETISISEAGFEKIFQGSC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P09961-F1 | 555-685 | 97.14 | 96.67 | View in AlphaFoldDB ↗ |