DPCfam | MC330009
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 177 ± 22 aa |
| Residues in low-complexity regions (%) | 9.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.34 |
| Average transmembrane regions | 2.85 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A150YM78 | 1-171 | 171 | MANNMPYRYAFFVIGICLFIFSPLIIFLIPRMIPMTFYFVKYTWVYYVPTEAYTVFAVGIAILIICCAFLFFGKMKKWAIISSSI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1K6Q7-F1 | 41-126 | 47.78 | 88.55 | View in AlphaFoldDB ↗ |