DPCfam | MC329997
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Residues in low-complexity regions (%) | 1.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.41 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF05895 |
| Sequences matching dominant architecture (%) | 3.41 |
| Average overlap percent | 4.99 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W2E4J4 | 147-237 | 91 | PDLLNGWYVQAGEVKGVCYYKDQFGYVHIYGAAEGGKTDFGTVLFNLPAGFRPSGIVRIGCVMINWEGYARSIQFLGVYPSGEVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5P3FZ45-F1 | 593-686 | 90.57 | 81.79 | View in AlphaFoldDB ↗ |