DPCfam | MC329963
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 65 ± 9 aa |
| Residues in low-complexity regions (%) | 4.11 |
| Residues in coiled-coil regions (%) | 1.6 |
| Predicted disordered residues (%) | 6.97 |
| Average transmembrane regions | 0.85 |
| Dominant Pfam architecture(s) | PF05648 |
| Sequences matching dominant architecture (%) | 88.24 |
| Average overlap percent | 33.52 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1GCN1 | 130-198 | 69 | EEKRRLMNERSEELIKKQRLEVISMIRGGLDLVHAVSTLPKGYLWGGKLETWHVGLIGTTSAALGLYQI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96HA9-F1 | 170-229 | 89.55 | 95.82 | View in AlphaFoldDB ↗ |