DPCfam | MC329818
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Residues in low-complexity regions (%) | 3.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03737 |
| Sequences matching dominant architecture (%) | 97.9 |
| Average overlap percent | 48.38 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003B52D7E | 9-80 | 72 | TSDIYDDFEDEVASLDLQLQSLGQHRQFHGRIRTVKCLHDNGLVKAIAEEPGNGQVLVVDGGGSLHTALMGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0A9G6-F1 | 4-76 | 98.65 | 98.19 | View in AlphaFoldDB ↗ |