DPCfam | MC329673
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Residues in low-complexity regions (%) | 1.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14496 |
| Sequences matching dominant architecture (%) | 94.29 |
| Average overlap percent | 4.53 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004AD4811 | 384-451 | 68 | RRIAPEDYEAMQEQLIDAMGEEFDDRLKKRLAALNLTGDGDAERQLGVEVRKEIEREIKGALRDKVLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32F09-F1 | 485-560 | 95.00 | 88.50 | View in AlphaFoldDB ↗ |