DPCfam | MC329610
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 515 ± 54 aa |
| Residues in low-complexity regions (%) | 1.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.98 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C5VCV5 | 68-632 | 565 | WYCGLYKNQKAQSQPLALVAFRELGKSGDLSDQLTYRRVPITALGQVRHGSIWSGGMCHGVHEFETERFQVDFLQGGWKFTSFNQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P05845-F1 | 188-362 | 32.14 | 78.22 | View in AlphaFoldDB ↗ |