DPCfam | MC32929
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Residues in low-complexity regions (%) | 1.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13086 |
| Sequences matching dominant architecture (%) | 92.68 |
| Average overlap percent | 35.38 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C5KAL8 | 1101-1195 | 95 | DIHKDLELATVCWRHIEDMFTRLEETHPFELLRNSHDRGIYLLTTHAKIVAMTCTHAALVRDTLLKLSFQYDNIVMEEAGQVLEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QQV6-F1 | 988-1079 | 100.00 | 91.93 | View in AlphaFoldDB ↗ |