DPCfam | MC329175
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 137 ± 9 aa |
| Residues in low-complexity regions (%) | 0.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15432 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 90.33 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R1VC85 | 40-172 | 133 | GHAYWFGSTIRRLAKDQWYFRNDLLPAGEVIYKWDLLFAYPIGRAFPRLPLLTPGHRYQLRLHADIDDPTTIYLRMITYDFQGKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9AET7-F1 | 24-152 | 92.81 | 91.05 | View in AlphaFoldDB ↗ |