DPCfam | MC32884
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Residues in low-complexity regions (%) | 1.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14625- PF00095 |
| Sequences matching dominant architecture (%) | 1.59 |
| Average overlap percent | 71.58 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V1I698 | 28-118 | 91 | MGNTPTTSATANLVIGIKRAQESQNSKLYRLVDYNGEGELIQWMKYSMSIGDYNILDGLIELKITPFLYGGGKGKLVPISELVKM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0N4UP80-F1 | 18-90 | 94.74 | 86.58 | View in AlphaFoldDB ↗ |