DPCfam | MC328793
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 254 ± 39 aa |
| Residues in low-complexity regions (%) | 4.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 51.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00628 |
| Sequences matching dominant architecture (%) | 7.14 |
| Average overlap percent | 18.44 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005816FDC | 322-575 | 254 | VDETDDSDMVEHDVKVCDICGDAGREDLLAICCRCSDGAEHTYCMREMMEKVPEGEWLCEECKTMDQEGVGRQEKNGGMDENEKN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LFW6-F1 | 236-480 | 99.64 | 49.68 | View in AlphaFoldDB ↗ |