DPCfam | MC328679
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 421 ± 82 aa |
| Residues in low-complexity regions (%) | 8.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09346 |
| Sequences matching dominant architecture (%) | 61.11 |
| Average overlap percent | 22.79 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A059W9E2 | 5-517 | 513 | SFNWQDFLTRWQDEWVPRDAEDKDEEEEAPGDVLLGRPGAEEAAIAAAEKRLGRRLPPSYREFLAVSDGWQVGQMVGVYQLGGAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P94480-F1 | 10-65 | 14.21 | 96.35 | View in AlphaFoldDB ↗ |