DPCfam | MC328478
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 110 ± 16 aa |
| Residues in low-complexity regions (%) | 0.62 |
| Residues in coiled-coil regions (%) | 0.42 |
| Predicted disordered residues (%) | 13.92 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00494 |
| Sequences matching dominant architecture (%) | 93.84 |
| Average overlap percent | 37.46 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B6ZMX8 | 4-100 | 97 | LQQCYHLLNKTGRSVAITINVLDGELRDAECIYYLVVRALHTIQVDMTIHIDTKMAILTSFDKLILDRTWKYTESKDEHAIVLEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P53799-F1 | 36-137 | 100.00 | 96.59 | View in AlphaFoldDB ↗ |