DPCfam | MC328179
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 117 ± 17 aa |
| Residues in low-complexity regions (%) | 3.6 |
| Residues in coiled-coil regions (%) | 16.11 |
| Predicted disordered residues (%) | 40.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08513 |
| Sequences matching dominant architecture (%) | 1.37 |
| Average overlap percent | 22.22 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W5B7U8 | 100-207 | 108 | DDGAQIVDEKVAVLEFELRKAKDTIKSLRANLTQTAEQEAACLHNNVEKPTNGGTQTLGKSDTTDTIKPLELRAINHLVNEYLLN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6P6Y1-F1 | 169-283 | 100.00 | 72.50 | View in AlphaFoldDB ↗ |