DPCfam | MC328172
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 60 ± 9 aa |
| Residues in low-complexity regions (%) | 1.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.91 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF18036 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 45.39 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M4DVF2 | 3-66 | 64 | SFRRRTFSYDKLPAEPIRLSVLKLDGTSFDVNVTSSATVRDLKLAIETAFSHVPKKGPSKISWP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1MWT0-F1 | 37-98 | 96.88 | 85.65 | View in AlphaFoldDB ↗ |