DPCfam | MC32795
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Residues in low-complexity regions (%) | 7.03 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 29.13 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF00520 |
| Sequences matching dominant architecture (%) | 62.69 |
| Average overlap percent | 2.05 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3GBT4 | 8-82 | 75 | DLKASRRLPRLYGDVPSQLVARPLEDLDPFYRTHQTFMVLNKKRTIYRFSAKPALFILGPFHPVRSLAIQISVHS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P04775-F1 | 13-131 | 100.00 | 74.26 | View in AlphaFoldDB ↗ |