DPCfam | MC327923
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 90 ± 17 aa |
| Residues in low-complexity regions (%) | 9.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.06 |
| Average transmembrane regions | 0.75 |
| Dominant Pfam architecture(s) | PF07885 |
| Sequences matching dominant architecture (%) | 79.49 |
| Average overlap percent | 19.07 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000580BFCE | 240-330 | 91 | PGYVILSLIFILFGLAVVAASINLLVLRFMTTDSGEARRDDTELQSASHHVLTLDGEVVAVNGKLLASHVPVVHDTDDCVSVCSC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044RBI9-F1 | 217-328 | 99.07 | 60.88 | View in AlphaFoldDB ↗ |