DPCfam | MC32783
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Residues in low-complexity regions (%) | 7.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.72 |
| Average transmembrane regions | 2.12 |
| Dominant Pfam architecture(s) | PF01757 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.22 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M3APT1 | 94-205 | 112 | MVIGLIIRPGIFNSAVLDTGHVIQSLLFIPHFHPGIPQAIMPMLVPGWTLTYEIYFYLLFALFISSGSIGRFVLPSTAIIVISVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P26502-F1 | 76-171 | 95.00 | 95.64 | View in AlphaFoldDB ↗ |