DPCfam | MC327775
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 163 ± 26 aa |
| Residues in low-complexity regions (%) | 5.17 |
| Residues in coiled-coil regions (%) | 12.07 |
| Predicted disordered residues (%) | 35.37 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00098293BB | 524-734 | 211 | KKHRPSISDSEGDHADTGSESELDDEEGDDSGQPLTLEVVEEKLTELKANKRESRLHRQKIDAEMKLSRKEISKIKEKETNTKAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VUS3-F1 | 488-665 | 100.00 | 86.24 | View in AlphaFoldDB ↗ |