DPCfam | MC327601
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Residues in low-complexity regions (%) | 4.01 |
| Residues in coiled-coil regions (%) | 5.62 |
| Predicted disordered residues (%) | 32.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12022 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.62 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A167LC17 | 803-878 | 76 | MKKTEDSLRRLKQGKKTAFSLFGSSTASPKEEEGKDEERVKKQMFLDVTALGKDAETLGVNTGESESFRGLMQTIG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q921L5-F1 | 638-719 | 97.67 | 79.87 | View in AlphaFoldDB ↗ |