DPCfam | MC327196
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 167 ± 18 aa |
| Residues in low-complexity regions (%) | 18.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06957 |
| Sequences matching dominant architecture (%) | 96.88 |
| Average overlap percent | 37.45 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6K3G4 | 80-231 | 152 | SLLIPPAPLTASGDWPLLRVMRGIFEGGLDATGKAELEEDDEAAGADWGDEDLDMVDASEAMANGGDGFDAEEGEANEEDGEEGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P53621-F1 | 792-967 | 99.44 | 54.78 | View in AlphaFoldDB ↗ |