DPCfam | MC32694
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 109 ± 16 aa |
| Residues in low-complexity regions (%) | 13.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.15 |
| Average transmembrane regions | 3.03 |
| Dominant Pfam architecture(s) | PF05940 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 31.36 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1N7MLM0 | 14-135 | 122 | ITAEPFRLMHLAAGLGAFLAMLIWAVHLGGLGMPLALRMPAAQWHAHELVFGYGGAVLAGIFMGAPPRGLSRRAFVLMAAGLWLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I0H6-F1 | 15-125 | 98.25 | 96.54 | View in AlphaFoldDB ↗ |