DPCfam | MC326726
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 256 ± 40 aa |
| Residues in low-complexity regions (%) | 3.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.38 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D8PM61 | 119-363 | 245 | VEQLEISAESLALPCAVAYTWSSLRVLVITGFWISNDSETPLDDARLKTPASIYEHVHLGTLINATPNLRILRIRWRYIFLPEPR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PGH5-F1 | 533-627 | 35.37 | 92.11 | View in AlphaFoldDB ↗ |