DPCfam | MC326716
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 110 ± 14 aa |
| Residues in low-complexity regions (%) | 3.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.38 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF12612 |
| Sequences matching dominant architecture (%) | 98.86 |
| Average overlap percent | 58.66 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A066WB04 | 540-653 | 114 | IETFEEYLPPGLWHQAIGEVLKQGVERLDNVRAVAGEQLMHLLWNSDIRSHAAGPWAVPGLNKLELAFPLDQAVPWNVGEWLFPR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8BYA0-F1 | 902-1008 | 98.17 | 94.48 | View in AlphaFoldDB ↗ |