DPCfam | MC326635
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3041 |
|---|---|
| Mean domain length (aa) | 224 ± 29 aa |
| Residues in low-complexity regions (%) | 5.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.81 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02602 |
| Sequences matching dominant architecture (%) | 97.57 |
| Average overlap percent | 90.98 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D4XLS7 | 3-212 | 210 | FINTRPQDRADRLTQAMQDAGYQVEHLPLLELIAVPLSEELQQLYQQLDQVQVIVVVSPTAVDIGMKYLVKSGLNLHQLAHIRWI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F7L5-F1 | 257-486 | 95.68 | 92.48 | View in AlphaFoldDB ↗ |