DPCfam | MC326363
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1031 |
|---|---|
| Mean domain length (aa) | 325 ± 74 aa |
| Residues in low-complexity regions (%) | 1.35 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 13.35 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF12017 |
| Sequences matching dominant architecture (%) | 70.29 |
| Average overlap percent | 43.24 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151IWB7 | 1-222 | 222 | LPHLSTVRKWHAGIDIKSGICEAALEILTEKHVKANNTGKKLLCSMMVDDIAIRKHVRWNGKKFTGFVTYNKSNMKNVKTNRQRS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7M3K2-F1 | 168-532 | 99.73 | 92.64 | View in AlphaFoldDB ↗ |