DPCfam | MC326214
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 225 ± 17 aa |
| Residues in low-complexity regions (%) | 4.29 |
| Residues in coiled-coil regions (%) | 0.37 |
| Predicted disordered residues (%) | 10.69 |
| Average transmembrane regions | 2.07 |
| Dominant Pfam architecture(s) | PF10412 |
| Sequences matching dominant architecture (%) | 70.31 |
| Average overlap percent | 11.21 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009B5E9D9 | 39-224 | 186 | LVLGMQIWVVIPRRVAMAEYWYWRVRVLLGFGATLDRPVLISVNQQSLQSSLGTLLHAPFIEQGHRSFWQHLTPALVLALTIGGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GZJ9-F1 | 7-230 | 100.00 | 86.64 | View in AlphaFoldDB ↗ |