DPCfam | MC326041
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 227 ± 26 aa |
| Residues in low-complexity regions (%) | 14.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.43 |
| Average transmembrane regions | 5.57 |
| Dominant Pfam architecture(s) | PF10110 |
| Sequences matching dominant architecture (%) | 0.85 |
| Average overlap percent | 44.02 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00059F6331 | 4-215 | 212 | KKVFAGAVFSLLQQRLVLAKALLLPMVAYLVLGFVSYLEAGIMLQVFVWLLSTVVEVLIAVTTHRIVLLGAGSVPAWGIFVPTAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P44056-F1 | 23-238 | 93.75 | 88.09 | View in AlphaFoldDB ↗ |