DPCfam | MC325958
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 120 ± 15 aa |
| Residues in low-complexity regions (%) | 3.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00440 |
| Sequences matching dominant architecture (%) | 15.38 |
| Average overlap percent | 1.76 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00029ADD6C | 82-205 | 124 | HQTFPEGIRALLCRYFDWVEANRDWALYLLRVATADLTPEGACAIDEINRRTRDDLALWLKPYVDRGEVVSLPADLYSSLVFGAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I2Q9-F1 | 73-191 | 96.75 | 97.73 | View in AlphaFoldDB ↗ |