DPCfam | MC325927
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 486 ± 41 aa |
| Residues in low-complexity regions (%) | 3.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04471 |
| Sequences matching dominant architecture (%) | 9.09 |
| Average overlap percent | 14.32 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J6VXX8 | 5-558 | 554 | VEWSELGGDEAETVVANLLYSERRSSTRVRPSRGDFGIDVLDPSKREAGKYDVYQIKRYAKTLTASQKKEIEKSFRRVLVGLVRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P55386-F1 | 36-134 | 21.12 | 84.69 | View in AlphaFoldDB ↗ |