DPCfam | MC3252
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 278 ± 42 aa |
| Residues in low-complexity regions (%) | 6.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 41.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005249254 | 3110-3288 | 179 | VQVPGDGLCLLHSIAVSTPGAAGSRSTAEQLRSAVENHFGTLPPEQWPTELVSNHRNDLIARNALGSGNPLGLPADTLQTLGDHA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6Z3T8-F1 | 248-299 | 17.13 | 93.98 | View in AlphaFoldDB ↗ |