DPCfam | MC325085
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 367 ± 43 aa |
| Residues in low-complexity regions (%) | 2.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.0 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00004 |
| Sequences matching dominant architecture (%) | 0.49 |
| Average overlap percent | 26.7 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6Z8E8 | 408-803 | 396 | NDATITTALARNAIWTQISKQDKKGSRCDPPVRLVQMLLKANDYTYPPVLNAIARQPYYHPDNGKLILGPGYDQSSGIFGAFEEV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58556-F1 | 495-600 | 28.32 | 80.83 | View in AlphaFoldDB ↗ |