DPCfam | MC324839
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 216 ± 29 aa |
| Residues in low-complexity regions (%) | 13.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 65.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04499 |
| Sequences matching dominant architecture (%) | 8.7 |
| Average overlap percent | 19.55 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| O75170-3 | 545-784 | 240 | MTANFVDQFGFNDEEFADQDDNINAPFDRIAEINFNIDADEDSPSAALFEACCSDRIQPFDDDEDEDIWEDSDTRCAARVMARPR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A286YB73-F1 | 554-758 | 99.49 | 38.91 | View in AlphaFoldDB ↗ |