DPCfam | MC324777
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 298 ± 28 aa |
| Residues in low-complexity regions (%) | 4.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.01 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D1A7I0 | 68-407 | 340 | DAPDPAQPAMRATPGPLTPAAPPEPVPLERLWPQAVRTVPDRLPGGRRYRPITLLDDTRLLVATESGFEKTDQLLTYDLDARRVT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q28TS0-F1 | 274-349 | 28.38 | 96.61 | View in AlphaFoldDB ↗ |