DPCfam | MC32435
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 287 ± 33 aa |
| Residues in low-complexity regions (%) | 1.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07676 |
| Sequences matching dominant architecture (%) | 3.77 |
| Average overlap percent | 5.81 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A8FAG7 | 46-348 | 303 | ELLVSFTDQQLNNTYYLHDRALHTEKLTAYPSIAYDSTKQLLYYTYTDEDTQKVSIRELNVKKDEEKTLFTSHDSIDSMRLSGDG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34353-F1 | 39-344 | 97.63 | 94.82 | View in AlphaFoldDB ↗ |