DPCfam | MC32427
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Residues in low-complexity regions (%) | 1.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02223 |
| Sequences matching dominant architecture (%) | 85.42 |
| Average overlap percent | 16.63 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G1R3G8 | 74-133 | 60 | KKRDLHEKDLKHLRDAERVYLEIAESFPKFSLISCTESGNIMTRERISDMVWDKIRKIVK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4HUB3-F1 | 295-350 | 94.64 | 87.80 | View in AlphaFoldDB ↗ |